Help
Input Sequence:
The amino acid sequence should be strictly in FASTA format and must contain only one sequence of standard amino acids in each request. Sequence length should not exceed 1000 amino acids, as the inbuilt solvent accessibility program ACCpro requires this sequences in this format.
Example sequence:
>example
SQEVMKNLSLNFGKALDECKKEMTLTDAINEDFYNFWKEGYEIKNRETGCAIMCLSTKLNMLDPEG
*First line : Start with ">" and brief summary description about the protein and it's source.
*Second line: Single line of standard amino acids.
Output Results:
Sample Output